PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000819856
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 230aa    MW: 26744.3 Da    PI: 5.4126
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000819856genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.3e-13855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEde+l  +v++ G+++W++ a++ g++R++ +c+ rw++yl
    MDP0000819856  8 KGPWLEEEDERLTTVVNLKGNRRWDAXAKESGLRRSGRSCRMRWLNYL 55
                     79********************************************97 PP

2Myb_DNA-binding45.31.9e-1468106848
                      HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      E++ ++++++++G++ W++Iar ++ gRt++++k++w+++l
    MDP0000819856  68 EEKTILQLHQRWGNK-WSKIARALP-GRTDNEIKNYWRTHL 106
                      99*************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.935355IPR017930Myb domain
SuperFamilySSF466891.48E-246102IPR009057Homeodomain-like
SMARTSM007172.9E-10757IPR001005SANT/Myb domain
PfamPF002496.4E-12855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-17962IPR009057Homeodomain-like
CDDcd001674.84E-71055No hitNo description
PROSITE profilePS5129422.22656110IPR017930Myb domain
SMARTSM007178.6E-1260108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2263109IPR009057Homeodomain-like
PfamPF002495.0E-1368106IPR001005SANT/Myb domain
CDDcd001673.65E-968106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MDGEKLRKGP WLEEEDERLT TVVNLKGNRR WDAXAKESGL RRSGRSCRMR WLNYLRPNIK  60
HGQITIIEEK TILQLHQRWG NKWSKIARAL PGRTDNEIKN YWRTHLKKKT QIPDGNFQCT  120
LNKNGRGLFC QEGDMNNEKY DFDQDHDSVK NSWETKVTSS DDLGLSDFAV TNSPYETQLS  180
DWISELSSEQ NGTAYNQDCN SVESDLCHLT WTPDDSDTWD CPSFLWDMN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-2461102105MYB PROTO-ONCOGENE PROTEIN
1h88_C5e-24611056159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-24611056159MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-2461102105C-Myb DNA-Binding Domain
1msf_C2e-2461102105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008350343.11e-170PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB59-like
RefseqXP_008387530.11e-170PREDICTED: transcription factor MYB59
SwissprotQ53NK61e-47MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLM5VUK71e-127M5VUK7_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s12400.12e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131692631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.13e-58myb domain protein 27